PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo14G0014400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 182aa    MW: 19510 Da    PI: 7.5714
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo14G0014400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof102.91.9e-321669356
           zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrr 56
                     e++l+cprC+stntkfCy+nn+s++qPry+Ck+C r+Wt+GG+lrn+P+Gg+  
  Spipo14G0014400 16 EQNLPCPRCQSTNTKFCYFNNHSITQPRYLCKGCGRHWTHGGSLRNIPIGGAPP 69
                     6889**********************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-191673IPR003851Zinc finger, Dof-type
PfamPF027016.9E-291767IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.0241973IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102157IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MQHPTAAAAA AVLVVEQNLP CPRCQSTNTK FCYFNNHSIT QPRYLCKGCG RHWTHGGSLR  60
NIPIGGAPPE EHQARRRSNN RPAVIPTAVP QPQPPLYHPN IEATSSLYAS TAEIDHLMLN  120
MTGSFTALLS SDSVFHNVVD NFQEEPAFLA PRGISSVGYT TLDLLSFPSG GASTPPPPPT  180
P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G45610.11e-26Dof family protein